Protein Info for b3575 in Escherichia coli BW25113

Name: yiaK
Annotation: 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF02615: Ldh_2" amino acids 3 to 330 (328 residues), 346.6 bits, see alignment E=7.4e-108

Best Hits

Swiss-Prot: 100% identical to DLGD_ECOLC: 2,3-diketo-L-gulonate reductase (dlgD) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: K08092, 3-dehydro-L-gulonate 2-dehydrogenase [EC: 1.1.1.130] (inferred from 100% identity to eco:b3575)

MetaCyc: 100% identical to 2,3-diketo-L-gulonate reductase (Escherichia coli K-12 substr. MG1655)
3-dehydro-L-gulonate 2-dehydrogenase. [EC: 1.1.1.130]

Predicted SEED Role

"3-dehydro-L-gulonate 2-dehydrogenase (EC 1.1.1.130)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 1.1.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37672 at UniProt or InterPro

Protein Sequence (332 amino acids)

>b3575 2,3-diketo-L-gulonate dehydrogenase, NADH-dependent (NCBI) (Escherichia coli BW25113)
MKVTFEQLKAAFNRVLISRGVDSETADACAEMFARTTESGVYSHGVNRFPRFIQQLENGD
IIPDAQPKRITSLGAIEQWDAQRSIGNLTAKKMMDRAIELAADHGIGLVALRNANHWMRG
GSYGWQAAEKGYIGICWTNSIAVMPPWGAKECRIGTNPLIVAIPSTPITMVDMSMSMFSY
GMLEVNRLAGRQLPVDGGFDDEGNLTKEPGVIEKNRRILPMGYWKGSGMSIVLDMIATLL
SDGASVAEVTQDNSDEYGISQIFIAIEVDKLIDGPTRDAKLQRIMDYVTSAERADENQAI
RLPGHEFTTLLAENRRNGITVDDSVWAKIQAL