Protein Info for b3569 in Escherichia coli BW25113

Name: xylR
Annotation: DNA-binding transcriptional activator, xylose-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF22177: PBP1_XylR" amino acids 7 to 104 (98 residues), 156.8 bits, see alignment E=3.8e-50 PF13407: Peripla_BP_4" amino acids 73 to 258 (186 residues), 47.7 bits, see alignment E=3.7e-16 PF13377: Peripla_BP_3" amino acids 113 to 277 (165 residues), 133.7 bits, see alignment E=1.7e-42 PF00165: HTH_AraC" amino acids 294 to 335 (42 residues), 35.1 bits, see alignment 2.7e-12 amino acids 347 to 384 (38 residues), 45.9 bits, see alignment 1.2e-15 PF12833: HTH_18" amino acids 309 to 384 (76 residues), 71.1 bits, see alignment E=1.9e-23

Best Hits

Swiss-Prot: 100% identical to XYLR_ECOLI: Xylose operon regulatory protein (xylR) from Escherichia coli (strain K12)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to eco:b3569)

Predicted SEED Role

"Xylose activator XylR (AraC family)" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACI3 at UniProt or InterPro

Protein Sequence (392 amino acids)

>b3569 DNA-binding transcriptional activator, xylose-binding (NCBI) (Escherichia coli BW25113)
MFTKRHRITLLFNANKAYDRQVVEGVGEYLQASQSEWDIFIEEDFRARIDKIKDWLGDGV
IADFDDKQIEQALADVDVPIVGVGGSYHLAESYPPVHYIATDNYALVESAFLHLKEKGVN
RFAFYGLPESSGKRWATEREYAFRQLVAEEKYRGVVYQGLETAPENWQHAQNRLADWLQT
LPPQTGIIAVTDARARHILQVCEHLHIPVPEKLCVIGIDNEELTRYLSRVALSSVAQGAR
QMGYQAAKLLHRLLDKEEMPLQRILVPPVRVIERRSTDYRSLTDPAVIQAMHYIRNHACK
GIKVDQVLDAVGISRSNLEKRFKEEVGETIHAMIHAEKLEKARSLLISTTLSINEISQMC
GYPSLQYFYSVFKKAYDTTPKEYRDVNSEVML