Protein Info for b3557 in Escherichia coli BW25113

Name: insJ
Annotation: IS150 protein InsA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF13518: HTH_28" amino acids 10 to 60 (51 residues), 40.2 bits, see alignment E=6.8e-14 amino acids 68 to 116 (49 residues), 37.1 bits, see alignment E=6.7e-13

Best Hits

Swiss-Prot: 100% identical to INSJ_ECOLI: Insertion element IS150 protein InsJ (insJ) from Escherichia coli (strain K12)

KEGG orthology group: K07483, transposase (inferred from 100% identity to eco:b3557)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P19768 at UniProt or InterPro

Protein Sequence (173 amino acids)

>b3557 IS150 protein InsA (NCBI) (Escherichia coli BW25113)
MSKPKYPFEKRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVALYEKHGEKGLIPKPKG
VSADPELRIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVYEERGEAGLRALKIGTK
RNIAISVDPEKAASALELSKDRRIEDLERQVRFLETRLMYLKKLKALAHPTKK