Protein Info for b3526 in Escherichia coli BW25113

Name: kdgK
Annotation: ketodeoxygluconokinase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to KDGK_ECOLI: 2-dehydro-3-deoxygluconokinase (kdgK) from Escherichia coli (strain K12)

KEGG orthology group: K00874, 2-dehydro-3-deoxygluconokinase [EC: 2.7.1.45] (inferred from 100% identity to eco:b3526)

MetaCyc: 100% identical to 2-dehydro-3-deoxygluconokinase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxygluconokinase. [EC: 2.7.1.178, 2.7.1.45]

Predicted SEED Role

"2-dehydro-3-deoxygluconate kinase (EC 2.7.1.45)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.45)

MetaCyc Pathways

superpathway of hexuronide and hexuronate degradation (10/10 steps found)
superpathway of β-D-glucuronosides degradation (7/7 steps found)
D-galacturonate degradation I (5/5 steps found)
D-fructuronate degradation (4/4 steps found)
D-galactonate degradation (3/3 steps found)
4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
L-glucose degradation (3/7 steps found)
superpathway of microbial D-galacturonate and D-glucuronate degradation (19/31 steps found)
alginate degradation (1/7 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.178 or 2.7.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37647 at UniProt or InterPro

Protein Sequence (309 amino acids)

>b3526 ketodeoxygluconokinase (VIMSS) (Escherichia coli BW25113)
MSKKIAVIGECMIELSEKGADVKRGFGGDTLNTSVYIARQVDPAALTVHYVTALGTDSFS
QQMLDAWHGENVDTSLTQRMENRLPGLYYIETDSTGERTFYYWRNEAAAKFWLESEQSAA
ICEELANFDYLYLSGISLAILSPTSREKLLSLLRECRANGGKVIFDNNYRPRLWASKEET
QQVYQQMLECTDIAFLTLDDEDALWGQQPVEDVIARTHNAGVKEVVVKRGADSCLVSIAG
EGLVDVPAVKLPKEKVIDTTAAGDSFSAGYLAVRLTGGSAEDAAKRGHLTASTVIQYRGA
IIPREAMPA