Protein Info for b3493 in Escherichia coli BW25113

Name: pitA
Annotation: phosphate transporter, low-affinity (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 425 to 442 (18 residues), see Phobius details amino acids 473 to 494 (22 residues), see Phobius details PF01384: PHO4" amino acids 30 to 488 (459 residues), 311.8 bits, see alignment E=3.1e-97

Best Hits

Swiss-Prot: 100% identical to PITA_ECOL6: Low-affinity inorganic phosphate transporter 1 (pitA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to eco:b3493)

MetaCyc: 100% identical to metal phosphate:H+ symporter PitA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-114; TRANS-RXN-277; TRANS-RXN-278; TRANS-RXN-279; TRANS-RXN-280; TRANS-RXN0-550

Predicted SEED Role

"Low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFJ7 at UniProt or InterPro

Protein Sequence (499 amino acids)

>b3493 phosphate transporter, low-affinity (NCBI) (Escherichia coli BW25113)
MLHLFAGLDLHTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMRSQLAVVMAAVF
NFLGVLLGGLSVAYAIVHMLPTDLLLNMGSSHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNALMTGTSVVDALNIPKVLSIFGSLIVSPIVGLVFAGGLIFLLRRY
WSGTKKRARIHLTPAEREKKDGKKKPPFWTRIALILSAIGVAFSHGANDGQKGIGLVMLV
LIGVAPAGFVVNMNATGYEITRTRDAINNVEAYFEQHPALLKQATGADQLVPAPEAGATQ
PAEFHCHPSNTINALNRLKGMLTTDVESYDKLSLDQRSQMRRIMLCVSDTIDKVVKMPGV
SADDQRLLKKLKSDMLSTIEYAPVWIIMAVALALGIGTMIGWRRVATTIGEKIGKKGMTY
AQGMSAQMTAAVSIGLASYTGMPVSTTHVLSSSVAGTMVVDGGGLQRKTVTSILMAWVFT
LPAAVLLSGGLYWLSLQFL