Protein Info for b3479 in Escherichia coli BW25113

Name: nikD
Annotation: nickel transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02770: nickel import ATP-binding protein NikD
  • amino acids 18 to 245 (228 residues), 352.7 bits, E=3.8e-110
• PF00005: ABC_tran
  • amino acids 20 to 169 (150 residues), 98.4 bits, E=3e-32

Best Hits

Swiss-Prot: 100% identical to NIKD_ECOLI: Nickel import ATP-binding protein NikD (nikD) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to eco:b3479)

MetaCyc: 100% identical to nickel ABC transporter ATP binding subunit NikD (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel transport ATP-binding protein NikD (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

See P33593 at UniProt or InterPro

Protein Sequence (254 amino acids)

>b3479 nickel transporter subunit (NCBI) (Escherichia coli BW25113)
MPQQIELRNIALQAAQPLVHGVSLTLQRGRVLALVGGSGSGKSLTCAATLGILPAGVRQT
AGEILADGKPVSPCALRGIKIATIMQNPRSAFNPLHTMHTHARETCLALGKPADDATLTA
AIEAVGLENAARVLKLYPFEMSGGMLQRMMIAMAVLCESPFIIADEPTTDLDVVAQARIL
DLLESIMQKQAPGMLLVTHDMGVVARLADDVAVMSDGKIVEQGDVETLFNAPKHTVTRSL
VSAHLALYGMELAS