Protein Info for b3440 in Escherichia coli BW25113

Name: yhhX
Annotation: predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF01408: GFO_IDH_MocA" amino acids 3 to 121 (119 residues), 108.3 bits, see alignment E=6.1e-35 PF03447: NAD_binding_3" amino acids 30 to 118 (89 residues), 25.7 bits, see alignment E=2.4e-09 PF02894: GFO_IDH_MocA_C" amino acids 135 to 340 (206 residues), 160.7 bits, see alignment E=7.1e-51

Best Hits

Swiss-Prot: 100% identical to YHHX_ECOLI: Uncharacterized oxidoreductase YhhX (yhhX) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3440)

Predicted SEED Role

"FIG00553873: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P46853 at UniProt or InterPro

Protein Sequence (345 amino acids)

>b3440 predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain (NCBI) (Escherichia coli BW25113)
MVINCAFIGFGKSTTRYHLPYVLNRKDSWHVAHIFRRHAKPEEQAPIYSHIHFTSDLDEV
LNDPDVKLVVVCTHADSHFEYAKRALEAGKNVLVEKPFTPTLAQAKELFALAKSKGLTVT
PYQNRRFDSCFLTAKKAIESGKLGEIVEVESHFDYYRPVAETKPGLPQDGAFYGLGVHTM
DQIISLFGRPDHVAYDIRSLRNKANPDDTFEAQLFYGDLKAIVKTSHLVKIDYPKFIVHG
KKGSFIKYGIDQQETSLKANIMPGEPGFAADDSVGVLEYVNDEGVTVREEMKPEMGDYGR
VYDALYQTITHGAPNYVKESEVLTNLEILERGFEQASPSTVTLAK