Protein Info for b3437 in Escherichia coli BW25113

Name: gntK
Annotation: gluconokinase 2, thermoresistant (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 TIGR01313: carbohydrate kinase, thermoresistant glucokinase family" amino acids 11 to 173 (163 residues), 241.5 bits, see alignment E=1.9e-76 PF13671: AAA_33" amino acids 12 to 127 (116 residues), 29.6 bits, see alignment E=1.2e-10 PF01583: APS_kinase" amino acids 12 to 120 (109 residues), 26.1 bits, see alignment E=1.2e-09 PF01202: SKI" amino acids 18 to 171 (154 residues), 31.7 bits, see alignment E=2.5e-11

Best Hits

Swiss-Prot: 100% identical to GNTK_ECOLI: Thermoresistant gluconokinase (gntK) from Escherichia coli (strain K12)

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 100% identity to eco:b3437)

MetaCyc: 100% identical to D-gluconate kinase, thermostable (Escherichia coli K-12 substr. MG1655)
Gluconokinase. [EC: 2.7.1.12]

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.12

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P46859 at UniProt or InterPro

Protein Sequence (175 amino acids)

>b3437 gluconokinase 2, thermoresistant (VIMSS) (Escherichia coli BW25113)
MSTTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDD
DRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESR
LKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKKGK