Protein Info for b3385 in Escherichia coli BW25113

Name: gph
Annotation: phosphoglycolate phosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00702: Hydrolase" amino acids 7 to 204 (198 residues), 135.9 bits, see alignment E=5.7e-43 PF13419: HAD_2" amino acids 10 to 209 (200 residues), 130.5 bits, see alignment E=1.9e-41 PF12710: HAD" amino acids 10 to 201 (192 residues), 51.2 bits, see alignment E=5.3e-17 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 10 to 239 (230 residues), 342.2 bits, see alignment E=2.2e-106 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 95 to 209 (115 residues), 54 bits, see alignment E=4.3e-18 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 116 to 204 (89 residues), 46 bits, see alignment E=1.5e-15 PF13242: Hydrolase_like" amino acids 166 to 235 (70 residues), 41.4 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 100% identical to GPH_ECOLI: Phosphoglycolate phosphatase (gph) from Escherichia coli (strain K12)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to eco:b3385)

MetaCyc: 100% identical to phosphoglycolate phosphatase (Escherichia coli K-12 substr. MG1655)
Phosphoglycolate phosphatase. [EC: 3.1.3.18]

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32662 at UniProt or InterPro

Protein Sequence (252 amino acids)

>b3385 phosphoglycolate phosphatase (NCBI) (Escherichia coli BW25113)
MNKFEDIRGVAFDLDGTLVDSAPGLAAAVDMALYALELPVAGEERVITWIGNGADVLMER
ALTWARQERATQRKTMGKPPVDDDIPAEEQVRILRKLFDRYYGEVAEEGTFLFPHVADTL
GALQAKGLPLGLVTNKPTPFVAPLLEALDIAKYFSVVIGGDDVQNKKPHPDPLLLVAERM
GIAPQQMLFVGDSRNDIQAAKAAGCPSVGLTYGYNYGEAIDLSQPDVIYQSINDLLPALG
LPHSENQESKND