Protein Info for b3380 in Escherichia coli BW25113

Name: yhfW
Annotation: predicted mutase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF01676: Metalloenzyme" amino acids 3 to 388 (386 residues), 191.7 bits, see alignment E=1.7e-60 PF01663: Phosphodiest" amino acids 264 to 344 (81 residues), 25.1 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 100% identical to YHFW_ECOLI: Uncharacterized protein YhfW (yhfW) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3380)

Predicted SEED Role

"Phosphopentomutase like (EC 5.4.2.7)" (EC 5.4.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.7

Use Curated BLAST to search for 5.4.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P45549 at UniProt or InterPro

Protein Sequence (408 amino acids)

>b3380 predicted mutase (NCBI) (Escherichia coli BW25113)
MARFVVLVIDSFGVGAMKDVTLVRPQDAGANTCGHILSQLPHLQLPTLETLGLINALGYA
PGDMQPSDSATWGVAELQHEGGDTFMGHQEILGTRPLPPLRMPFRDVIDRVEQALVSAGW
QVERRGDDLQFLWVNQAVAIGDNLEADLGQVYNITANLSVISFDDAIKIGRIVREQVQVG
RVITFGGLLTDSQRILDAAESKEGRFIGINAPRSGAYDNGFQVVHMGYGVDEKVQVPQKL
YEAGVPTVLVGKVADIVNNPYGVSWQNLVDSQRIMDITLNEFNTHPTAFICTNIQETDLA
GHAEDVARYAERLQVVDRNLARLVEAMQPDDCLVVMADHGNDPTIGHSHHTREVVPVLVY
QQGMIATQLGVRTTLSDVGATVCEFFRAPPPQNGRSFLSSLRFAGDTL