Protein Info for b3374 in Escherichia coli BW25113

Name: frlD
Annotation: fructoselysine 6-kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00294: PfkB" amino acids 22 to 260 (239 residues), 132.9 bits, see alignment E=8.1e-43

Best Hits

Swiss-Prot: 100% identical to FRLD_ECOLI: Fructoselysine 6-kinase (frlD) from Escherichia coli (strain K12)

KEGG orthology group: K10710, fructoselysine 6-kinase [EC: 2.7.1.-] (inferred from 100% identity to eco:b3374)

MetaCyc: 100% identical to fructoselysine 6-kinase (Escherichia coli K-12 substr. MG1655)
RXN0-962 [EC: 2.7.1.218]

Predicted SEED Role

"Fructoselysine kinase (EC 2.7.1.-)" (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.- or 2.7.1.218

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P45543 at UniProt or InterPro

Protein Sequence (261 amino acids)

>b3374 fructoselysine 6-kinase (NCBI) (Escherichia coli BW25113)
MKTLATIGDNCVDIYPQLNKAFSGGNAVNVAVYCTRYGIQPGCITWVGDDDYGTKLKQDL
ARMGVDISHVHTKHGVTAQTQVELHDNDRVFGDYTEGVMADFALSEEDYAWLAQYDIVHA
AIWGHAEDAFPQLHAAGKLTAFDFSDKWDSPLWQTLVPHLDFAFASAPQEDETLRLKMKA
IVARGAGTVIVTLGENGSIAWDGAQFWRQAPEPVTVIDTMGAGDSFIAGFLCGWSAGMTL
PQAIAQGTACAAKTIQYHGAW