Protein Info for b3326 in Escherichia coli BW25113

Name: gspE
Annotation: general secretory pathway component, cryptic (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 TIGR02533: type II secretion system protein E" amino acids 25 to 484 (460 residues), 656.6 bits, see alignment E=1.2e-201 PF00437: T2SSE" amino acids 102 to 483 (382 residues), 545.8 bits, see alignment E=4e-168 PF13476: AAA_23" amino acids 219 to 300 (82 residues), 29.4 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 100% identical to GSPE_ECOLI: Putative type II secretion system protein E (gspE) from Escherichia coli (strain K12)

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 100% identity to eco:b3326)

MetaCyc: 100% identical to type II secretion system protein GspE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein E"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P45759 at UniProt or InterPro

Protein Sequence (493 amino acids)

>b3326 general secretory pathway component, cryptic (NCBI) (Escherichia coli BW25113)
MRIHSPYPASWALAQRIGYLYSEGEIIYLADTPFERLLDIQRQVGQCQTMTSLSQADFEA
RLEAVFHQNTGESQQIAQDIDQSVDLLSLSEEMPANEDLLNEDSAAPVIRLINAILSEAI
KETASDIHIETYEKTMSIRFRIDGVLRTILQPNKKLAALLISRIKVMARLDIAEKRIPQD
GRISLRIGRRNIDVRVSTLPSIYGERAVLRLLDKNSLQLSLNNLGMTAADKQDLENLIQL
PHGIILVTGPTGSGKSTTLYAILSALNTPGRNILTVEDPVEYELEGIGQTQVNTRVDMSF
ARGLRAILRQDPDVVMVGEIRDTETAQIAVQASLTGHLVLSTLHTNSASGAVTRLRDMGV
ESFLLSSSLAGIIAQRLVRRLCPQCRQFTPVSPQQAQMFKYHQLAVTTIGTPVGCPHCHQ
SGYQGRMAIHEMMVVTPELRAAIHENVDEQALERLVRQQHKALIKNGLQKVISGDTSWDE
VMRVASATLESEA