Protein Info for b3265 in Escherichia coli BW25113

Name: acrE
Annotation: cytoplasmic membrane lipoprotein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 39 to 374 (336 residues), 287.2 bits, see alignment E=7.1e-90 PF25917: BSH_RND" amino acids 63 to 206 (144 residues), 106.9 bits, see alignment E=9.7e-35 PF25876: HH_MFP_RND" amino acids 104 to 173 (70 residues), 94.1 bits, see alignment E=1.3e-30 PF25944: Beta-barrel_RND" amino acids 210 to 299 (90 residues), 122.1 bits, see alignment E=2.6e-39 PF25954: Beta-barrel_RND_2" amino acids 238 to 297 (60 residues), 23.1 bits, see alignment E=1.7e-08 PF25967: RND-MFP_C" amino acids 303 to 365 (63 residues), 92.1 bits, see alignment E=4.1e-30

Best Hits

Swiss-Prot: 100% identical to ACRE_ECOLI: Multidrug export protein AcrE (acrE) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 100% identity to eco:b3265)

MetaCyc: 100% identical to multidrug efflux pump membrane fusion lipoprotein AcrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-367

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P24180 at UniProt or InterPro

Protein Sequence (385 amino acids)

>b3265 cytoplasmic membrane lipoprotein (NCBI) (Escherichia coli BW25113)
MTKHARFFLLPSFILISAALIAGCNDKGEEKAHVGEPQVTVHIVKTAPLEVKTELPGRTN
AYRIAEVRPQVSGIVLNRNFTEGSDVQAGQSLYQIDPATYQANYDSAKGELAKSEAAAAI
AHLTVKRYVPLVGTKYISQQEYDQAIADARQADAAVIAAKATVESARINLAYTKVTAPIS
GRIGKSTVTEGALVTNGQTTELATVQQLDPIYVDVTQSSNDFMRLKQSVEQGNLHKENAT
SNVELVMENGQTYPLKGTLQFSDVTVDESTGSITLRAVFPNPQHTLLPGMFVRARIDEGV
QPDAILIPQQGVSRTPRGDATVLIVNDKSQVEARPVVASQAIGDKWLISEGLKSGDQVIV
SGLQKARPGEQVKATTDTPADTASK