Protein Info for b3256 in Escherichia coli BW25113

Name: accC
Annotation: acetyl-CoA carboxylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00289: Biotin_carb_N
  • amino acids 1 to 110 (110 residues), 152.8 bits, E=1.4e-48
• TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit
  • amino acids 1 to 447 (447 residues), 834.7 bits, E=9.2e-256
• PF02655: ATP-grasp_3
  • amino acids 114 to 294 (181 residues), 28.8 bits, E=3.7e-10
• PF02786: CPSase_L_D2
  • amino acids 115 to 323 (209 residues), 285.8 bits, E=5.8e-89
• PF02222: ATP-grasp
  • amino acids 143 to 292 (150 residues), 28.9 bits, E=2.6e-10
• PF07478: Dala_Dala_lig_C
  • amino acids 143 to 291 (149 residues), 29.6 bits, E=1.4e-10
• PF02785: Biotin_carb_C
  • amino acids 336 to 441 (106 residues), 133.3 bits, E=1.1e-42

Best Hits

Swiss-Prot: 100% identical to ACCC_ECOLI: Biotin carboxylase (accC) from Escherichia coli (strain K12)

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 100% identity to eco:b3256)

MetaCyc: 100% identical to biotin carboxylase (Escherichia coli K-12 substr. MG1655)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• jadomycin biosynthesis (3/9 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Sequence Analysis Tools

See P24182 at UniProt or InterPro

Protein Sequence (449 amino acids)

>b3256 acetyl-CoA carboxylase (NCBI) (Escherichia coli BW25113)
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAI
AAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQ
SISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVHVRGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDL
QIRIMNDENFQHGGTNIHYLEKKLGLQEK