Protein Info for b3251 in Escherichia coli BW25113

Name: mreB
Annotation: regulator of ftsI, penicillin binding protein 3, septation function (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 9 to 339 (331 residues), 565.2 bits, see alignment E=2.1e-174 PF06723: MreB_Mbl" amino acids 11 to 338 (328 residues), 498.4 bits, see alignment E=1.9e-153 PF00022: Actin" amino acids 52 to 204 (153 residues), 27.6 bits, see alignment E=2.9e-10 PF00012: HSP70" amino acids 104 to 207 (104 residues), 48.4 bits, see alignment E=1.1e-16 PF14450: FtsA" amino acids 162 to 320 (159 residues), 45.5 bits, see alignment E=2.4e-15

Best Hits

Swiss-Prot: 100% identical to MREB_ECOLI: Cell shape-determining protein MreB (mreB) from Escherichia coli (strain K12)

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 100% identity to eco:b3251)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9X4 at UniProt or InterPro

Protein Sequence (347 amino acids)

>b3251 regulator of ftsI, penicillin binding protein 3, septation function (VIMSS) (Escherichia coli BW25113)
MLKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAK
QMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFMRPSPRVLVCVPVGATQ
VERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMVVDIGGGTTEVAVISLNG
VVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEIGSAYPGDEVREIEVRGRN
LAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPELASDISERGMVLTGGGALL
RNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHGGDLFSEE