Protein Info for b3248 in Escherichia coli BW25113

Name: yhdE
Annotation: Maf-like protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00172: septum formation protein Maf
  • amino acids 2 to 182 (181 residues), 252.2 bits, E=1.2e-79
• PF02545: Maf
  • amino acids 4 to 184 (181 residues), 217.2 bits, E=7.7e-69

Best Hits

Swiss-Prot: 100% identical to NTPPA_ECOLI: dTTP/UTP pyrophosphatase (yhdE) from Escherichia coli (strain K12)

KEGG orthology group: K06287, septum formation protein (inferred from 100% identity to eco:b3248)

MetaCyc: 100% identical to nucleoside triphosphate pyrophosphatase YhdE (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]; 3.6.1.9 [EC: 3.6.1.9]

Predicted SEED Role

"Septum formation protein Maf" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (3/3 steps found)
• dZTP biosynthesis (3/5 steps found)
• tunicamycin biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Pantothenate and CoA biosynthesis
• Purine metabolism
• Riboflavin metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.9

Sequence Analysis Tools

See P25536 at UniProt or InterPro

Protein Sequence (197 amino acids)

>b3248 Maf-like protein (NCBI) (Escherichia coli BW25113)
MTSLYLASGSPRRQELLAQLGVTFERIVTGIEEQRQPQESAQQYVVRLAREKARAGVAQT
AKDLPVLGADTIVILNGEVLEKPRDAEHAAQMLRKLSGQTHQVMTAVALADSQHILDCLV
VTDVTFRTLTDEDIAGYVASDEPLDKAGAYGIQGLGGCFVRKINGSYHAVVGLPLVETYE
LLSNFNALREKRDKHDG