Protein Info for b3230 in Escherichia coli BW25113

Name: rpsI
Annotation: 30S ribosomal protein S9 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF00380: Ribosomal_S9" amino acids 10 to 130 (121 residues), 172 bits, see alignment E=3.3e-55

Best Hits

Swiss-Prot: 100% identical to RS9_ECOLU: 30S ribosomal protein S9 (rpsI) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: K02996, small subunit ribosomal protein S9 (inferred from 100% identity to eco:b3230)

MetaCyc: 100% identical to 30S ribosomal subunit protein S9 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S9p (S16e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A7X3 at UniProt or InterPro

Protein Sequence (130 amino acids)

>b3230 30S ribosomal protein S9 (NCBI) (Escherichia coli BW25113)
MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEK
LDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRK
ARRRPQFSKR