Protein Info for b3189 in Escherichia coli BW25113

Name: murA
Annotation: UDP-N-acetylglucosamine 1-carboxyvinyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to MURA_ECO7I: UDP-N-acetylglucosamine 1-carboxyvinyltransferase (murA) from Escherichia coli O7:K1 (strain IAI39 / ExPEC)

KEGG orthology group: K00790, UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC: 2.5.1.7] (inferred from 100% identity to eco:b3189)

MetaCyc: 100% identical to UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Escherichia coli K-12 substr. MG1655)
UDP-N-acetylglucosamine 1-carboxyvinyltransferase. [EC: 2.5.1.7]

Predicted SEED Role

"UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 2.5.1.7)

MetaCyc Pathways

peptidoglycan recycling I (14/14 steps found)
peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A749 at UniProt or InterPro

Protein Sequence (419 amino acids)

>b3189 UDP-N-acetylglucosamine 1-carboxyvinyltransferase (NCBI) (Escherichia coli BW25113)
MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQL
GAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGAR
PVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTT
IIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHP
AFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKL
SGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIERVKGE