Protein Info for b3176 in Escherichia coli BW25113

Name: glmM
Annotation: phosphoglucosamine mutase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 4 to 136 (133 residues), 157.6 bits, E=3e-50
• TIGR01455: phosphoglucosamine mutase
  • amino acids 7 to 443 (437 residues), 654.9 bits, E=2.7e-201
• PF02879: PGM_PMM_II
  • amino acids 157 to 254 (98 residues), 73.7 bits, E=3.2e-24
• PF02880: PGM_PMM_III
  • amino acids 258 to 366 (109 residues), 124.4 bits, E=5e-40
• PF00408: PGM_PMM_IV
  • amino acids 373 to 443 (71 residues), 69.3 bits, E=4.7e-23

Best Hits

Swiss-Prot: 100% identical to GLMM_ECOSE: Phosphoglucosamine mutase (glmM) from Escherichia coli (strain SE11)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to eco:b3176)

MetaCyc: 100% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• colanic acid building blocks biosynthesis (11/11 steps found)
• glycogen degradation I (8/8 steps found)
• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glucose and glucose-1-phosphate degradation (5/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• starch degradation III (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (7/24 steps found)
• streptomycin biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

See P31120 at UniProt or InterPro

Protein Sequence (445 amino acids)

>b3176 phosphoglucosamine mutase (NCBI) (Escherichia coli BW25113)
MSNRKYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVLARHGSRKIIIGKDTRISGYMLES
ALEAGLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTK
LPDAVEEAIEAEMEKEISCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIVVD
CANGATYHIAPNVLRELGANVIAIGCEPNGVNINAEVGATDVRALQARVLAEKADLGIAF
DGDGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRGGAVGTLMSNMGLELALKQLGIP
FARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARNHMSLH
DLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVEAALGNRGRVLLRKSGTEPLIR
VMVEGEDEAQVTEFAHRIADAVKAV