Protein Info for b3168 in Escherichia coli BW25113

Name: infB
Annotation: translation initiation factor IF-2 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 890 PF04760: IF2_N" amino acids 1 to 51 (51 residues), 36 bits, see alignment 1.9e-12 amino acids 314 to 364 (51 residues), 61 bits, see alignment 2.9e-20 PF08364: IF2_assoc" amino acids 56 to 94 (39 residues), 62.9 bits, see alignment (E = 9.7e-21) TIGR00487: translation initiation factor IF-2" amino acids 306 to 889 (584 residues), 987.9 bits, see alignment E=2e-301 TIGR00231: small GTP-binding protein domain" amino acids 393 to 548 (156 residues), 112.2 bits, see alignment E=2.1e-36 PF00009: GTP_EFTU" amino acids 393 to 549 (157 residues), 128.7 bits, see alignment E=8.3e-41 PF01926: MMR_HSR1" amino acids 394 to 499 (106 residues), 40.3 bits, see alignment E=1.2e-13 PF00071: Ras" amino acids 395 to 550 (156 residues), 24.7 bits, see alignment E=6.2e-09 PF00025: Arf" amino acids 396 to 548 (153 residues), 23.2 bits, see alignment E=1.7e-08 PF11987: IF-2" amino acids 665 to 779 (115 residues), 145.4 bits, see alignment E=2.8e-46 PF03144: GTP_EFTU_D2" amino acids 810 to 877 (68 residues), 38.8 bits, see alignment 4.2e-13

Best Hits

Swiss-Prot: 93% identical to IF2_CITK8: Translation initiation factor IF-2 (infB) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 94% identity to enc:ECL_04550)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A705 at UniProt or InterPro

Protein Sequence (890 amino acids)

>b3168 translation initiation factor IF-2 (NCBI) (Escherichia coli BW25113)
MTDVTIKTLAAERQTSVERLVQQFADAGIRKSADDSVSAQEKQTLIDHLNQKNSGPDKLT
LQRKTRSTLNIPGTGGKSKSVQIEVRKKRTFVKRDPQEAERLAAEEQAQREAEEQARREA
EESAKREAQQKAEREAAEQAKREAAEQAKREAAEKDKVSNQQDDMTKNAQAEKARREQEA
AELKRKAEEEARRKLEEEARRVAEEARRMAEENKWTDNAEPTEDSSDYHVTTSQHARQAE
DESDREVEGGRGRGRNAKAARPKKGNKHAESKADREEARAAVRGGKGGKRKGSSLQQGFQ
KPAQAVNRDVVIGETITVGELANKMAVKGSQVIKAMMKLGAMATINQVIDQETAQLVAEE
MGHKVILRRENELEEAVMSDRDTGAAAEPRAPVVTIMGHVDHGKTSLLDYIRSTKVASGE
AGGITQHIGAYHVETENGMITFLDTPGHAAFTSMRARGAQATDIVVLVVAADDGVMPQTI
EAIQHAKAAQVPVVVAVNKIDKPEADPDRVKNELSQYGILPEEWGGESQFVHVSAKAGTG
IDELLDAILLQAEVLELKAVRKGMASGAVIESFLDKGRGPVATVLVREGTLHKGDIVLCG
FEYGRVRAMRNELGQEVLEAGPSIPVEILGLSGVPAAGDEVTVVRDEKKAREVALYRQGK
FREVKLARQQKSKLENMFANMTEGEVHEVNIVLKADVQGSVEAISDSLLKLSTDEVKVKI
IGSGVGGITETDATLAAASNAILVGFNVRADASARKVIEAESLDLRYYSVIYNLIDEVKA
AMSGMLSPELKQQIIGLAEVRDVFKSPKFGAIAGCMVTEGVVKRHNPIRVLRDNVVIYEG
ELESLRRFKDDVNEVRNGMECGIGVKNYNDVRTGDVIEVFEIIEIQRTIA