Protein Info for b3093 in Escherichia coli BW25113

Name: exuT
Annotation: hexuronate transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 401 to 424 (24 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details PF07690: MFS_1" amino acids 56 to 333 (278 residues), 163.4 bits, see alignment E=3.5e-52 amino acids 341 to 457 (117 residues), 36.4 bits, see alignment E=1.5e-13 TIGR00893: D-galactonate transporter" amino acids 57 to 451 (395 residues), 426.2 bits, see alignment E=6.3e-132

Best Hits

Swiss-Prot: 100% identical to EXUT_ECOLI: Hexuronate transporter (exuT) from Escherichia coli (strain K12)

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to eco:b3093)

MetaCyc: 100% identical to hexuronate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-123; TRANS-RXN-35

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AA78 at UniProt or InterPro

Protein Sequence (472 amino acids)

>b3093 hexuronate transporter (NCBI) (Escherichia coli BW25113)
MATFGACRFFFGYPVVTNIFSLWRDDGRASCGYNKTMRFYMRKIKGLRWYMIALVTLGTV
LGYLTRNTVAAAAPTLMEELNISTQQYSYIIAAYSAAYTVMQPVAGYVLDVLGTKIGYAM
FAVLWAVFCGATALAGSWGGLAVARGAVGAAEAAMIPAGLKASSEWFPAKERSIAVGYFN
VGSSIGAMIAPPLVVWAIVMHSWQMAFIISGALSFIWAMAWLIFYKHPRDQKHLTDEERD
YIINGQEAQHQVSTAKKMSVGQILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKVYGF
NLKEIAMFAWMPMLFADLGCILGGYLPPLFQRWFGVNLIVSRKMVVTLGAVLMIGPGMIG
LFTNPYVAIMLLCIGGFAHQALSGALITLSSDVFGRNEVATANGLTGMSAWLASTLFALV
VGALADTIGFSPLFAVLAVFDLLGALVIWTVLQNKPAIEVAQETHNDPAPQH