Protein Info for b3030 in Escherichia coli BW25113

Name: parE
Annotation: DNA topoisomerase IV subunit B (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 TIGR01055: DNA topoisomerase IV, B subunit" amino acids 2 to 625 (624 residues), 1249.8 bits, see alignment E=0 PF02518: HATPase_c" amino acids 28 to 170 (143 residues), 52.8 bits, see alignment E=1e-17 PF00204: DNA_gyraseB" amino acids 218 to 384 (167 residues), 138.9 bits, see alignment E=2.4e-44 PF01751: Toprim" amino acids 413 to 521 (109 residues), 46.8 bits, see alignment E=5.5e-16 PF00986: DNA_gyraseB_C" amino acids 556 to 620 (65 residues), 86.3 bits, see alignment E=2.6e-28

Best Hits

Swiss-Prot: 100% identical to PARE_ECOLI: DNA topoisomerase 4 subunit B (parE) from Escherichia coli (strain K12)

KEGG orthology group: K02622, topoisomerase IV subunit B [EC: 5.99.1.-] (inferred from 100% identity to ecg:E2348C_3325)

Predicted SEED Role

"Topoisomerase IV subunit B (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P20083 at UniProt or InterPro

Protein Sequence (630 amino acids)

>b3030 DNA topoisomerase IV subunit B (NCBI) (Escherichia coli BW25113)
MTQTYNADAIEVLTGLEPVRRRPGMYTDTTRPNHLGQEVIDNSVDEALAGHAKRVDVILH
ADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVN
ALSKRVEVNVRRDGQVYNIAFENGEKVQDLQVVGTCGKRNTGTSVHFWPDETFFDSPRFS
VSRLTHVLKAKAVLCPGVEITFKDEINNTEQRWCYQDGLNDYLAEAVNGLPTLPEKPFIG
NFAGDTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNI
LPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQ
NVQAAELLAEMAISSAQRRMRAAKKVVRKKLTSGPALPGKLADCTAQDLNRTELFLVEGD
SAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLASQEVHDISVAIGIDPDSDDLSQL
RYGKICILADADSDGLHIATLLCALFVKHFRALVKHGHVYVALPPLYRIDLGKEVYYALT
EEEKEGVLEQLKRKKGKPNVQRFKGLGEMNPMQLRETTLDPNTRRLVQLTIDDEDDQRTD
AMMDMLLAKKRSEDRRNWLQEKGDMAEIEV