Protein Info for b3026 in Escherichia coli BW25113

Name: qseC
Annotation: sensory histidine kinase in two-component regulatory system with QseB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 7 to 14 (8 residues), see Phobius details amino acids 29 to 29 (1 residues), see Phobius details amino acids 33 to 33 (1 residues), see Phobius details transmembrane" amino acids 15 to 28 (14 residues), see Phobius details amino acids 30 to 32 (3 residues), see Phobius details amino acids 158 to 182 (25 residues), see Phobius details PF08521: 2CSK_N" amino acids 23 to 157 (135 residues), 34.4 bits, see alignment E=3.3e-12 PF00512: HisKA" amino acids 237 to 301 (65 residues), 47.2 bits, see alignment E=2.8e-16 PF02518: HATPase_c" amino acids 349 to 445 (97 residues), 75.5 bits, see alignment E=6.9e-25

Best Hits

Swiss-Prot: 100% identical to QSEC_ECOLI: Sensor protein QseC (qseC) from Escherichia coli (strain K12)

KEGG orthology group: K07645, two-component system, OmpR family, sensor histidine kinase QseC [EC: 2.7.13.3] (inferred from 100% identity to eco:b3026)

Predicted SEED Role

"Sensory histidine kinase QseC" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P40719 at UniProt or InterPro

Protein Sequence (449 amino acids)

>b3026 sensory histidine kinase in two-component regulatory system with QseB (NCBI) (Escherichia coli BW25113)
MKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNVDELFDTQLMLFAKRLSTLDL
NEINAADRMAQTPNRLKHGHVDDDALTFAIFTHDGRMVLNDGDNGEDIPYSYQREGFADG
QLVGEDDPWRFVWMTSPDGKYRIVVGQEWEYREDMALAIVAGQLIPWLVALPIMLIIMMV
LLGRELAPLNKLALALRMRDPDSEKPLNATGVPSEVRPLVESLNQLFARTHAMMVRERRF
TSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLD
SLDNLQDVAEIPLEDLLQSSVMDIYHTAQQAKIDVRLTLNAHSIKRTGQPLLLSLLVRNL
LDNAVRYSPQGSVVDVTLNADNFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLS
IVQRIAKLHGMNVEFGNAEQGGFEAKVSW