Protein Info for b3021 in Escherichia coli BW25113

Name: ygiT
Annotation: predicted DNA-binding transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF15731: MqsA_antitoxin" amino acids 1 to 131 (131 residues), 188.2 bits, see alignment E=3.2e-60 TIGR03831: YgiT-type zinc finger domain" amino acids 3 to 47 (45 residues), 43.1 bits, see alignment E=3.8e-15 TIGR03830: putative zinc finger/helix-turn-helix protein, YgiT family" amino acids 3 to 131 (129 residues), 146.5 bits, see alignment E=3.4e-47

Best Hits

Swiss-Prot: 100% identical to MQSA_ECOLI: Antitoxin MqsA (mqsA) from Escherichia coli (strain K12)

KEGG orthology group: K13655, HTH-type transcriptional regulator / antitoxin for MqsR toxin (inferred from 100% identity to eco:b3021)

MetaCyc: 100% identical to antitoxin of the MqsRA toxin-antitoxin system / DNA-binding transcriptional repressor MqsA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46864 at UniProt or InterPro

Protein Sequence (131 amino acids)

>b3021 predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113)
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAF
RASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVL
DKHPELLNEIR