Protein Info for b3010 in Escherichia coli BW25113

Name: yqhC
Annotation: putative ARAC-type regulatory protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 186 to 204 (19 residues), see Phobius details PF06719: AraC_N" amino acids 47 to 197 (151 residues), 138 bits, see alignment E=2.9e-44 PF00165: HTH_AraC" amino acids 219 to 260 (42 residues), 35.4 bits, see alignment 1.3e-12 amino acids 281 to 307 (27 residues), 29.7 bits, see alignment (E = 8.3e-11) PF12833: HTH_18" amino acids 232 to 307 (76 residues), 80.5 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 100% identical to YQHC_ECOLI: Uncharacterized HTH-type transcriptional regulator YqhC (yqhC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3010)

Predicted SEED Role

"Transcriptional regulator YqhC, positively regulates YqhD and DkgA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46855 at UniProt or InterPro

Protein Sequence (318 amino acids)

>b3010 putative ARAC-type regulatory protein (VIMSS) (Escherichia coli BW25113)
MLQNCAQSNCRIIPKKLRDMKREEICRLLADKVNKLKNKENSLSGLLPDVRLLYGETPFA
RTPVMYEPGIIILFSGHKIGYINERVFRYDANEYLLLTVPLPFECETYATSEVPLAGLRL
NVDILQLQELLMDIGEDEHFQPSMAASGINSATLSEEILCAAERLLDVMERPLDARILGK
QIIREILYYVLTGPCGGALLALVSRQTHFSLISRVLKRIENKYTENLSVEQLAAEANMSV
SAFHHNFKSVTSTSPLQYLKNYRLHKARMMIIHDGMKASAAAMRVGYESASQFSREFKRY
FGVTPGEDAARMRAMQGN