Protein Info for b2930 in Escherichia coli BW25113

Name: yggF
Annotation: predicted hexoseP phosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00330: fructose-1,6-bisphosphatase, class II" amino acids 1 to 321 (321 residues), 587.8 bits, see alignment E=3.1e-181 PF03320: FBPase_glpX" amino acids 3 to 321 (319 residues), 405.4 bits, see alignment E=6.6e-126

Best Hits

Swiss-Prot: 100% identical to GLPX2_ECOLI: Fructose-1,6-bisphosphatase 2 class 2 (yggF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2930)

MetaCyc: 100% identical to fructose 1,6-bisphosphatase YggF (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, GlpX type (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P21437 at UniProt or InterPro

Protein Sequence (321 amino acids)

>b2930 predicted hexoseP phosphatase (NCBI) (Escherichia coli BW25113)
MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEID
HAPMLWIGEEVGKGDGPEVDIAVDPIEGTRMVAMGQSNALAVMAFAPRDSLLHAPDMYMK
KLVVNRLAAGAIDLSLPLTDNLRNVAKALGKPLDKLRMVTLDKPRLSAAIEEATQLGVKV
FALPDGDVAASVLTCWQDNPYDVMYTIGGAPEGVISACAVKALGGDMQAELIDFCQAKGD
YTENRQIAEQERKRCKAMGVDVNRVYSLDELVRGNDILFSATGVTGGELVNGIQQTANGV
RTQTLLIGGADQTCNIIDSLH