Protein Info for b2914 in Escherichia coli BW25113

Name: rpiA
Annotation: ribose-5-phosphate isomerase A (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 TIGR00021: ribose 5-phosphate isomerase A" amino acids 6 to 215 (210 residues), 241.5 bits, see alignment E=3.4e-76 PF06026: Rib_5-P_isom_A" amino acids 49 to 213 (165 residues), 205.3 bits, see alignment E=2.7e-65

Best Hits

Swiss-Prot: 100% identical to RPIA_SHIFL: Ribose-5-phosphate isomerase A (rpiA) from Shigella flexneri

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 100% identity to eco:b2914)

MetaCyc: 100% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.6

Use Curated BLAST to search for 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A7Z0 at UniProt or InterPro

Protein Sequence (219 amino acids)

>b2914 ribose-5-phosphate isomerase A (NCBI) (Escherichia coli BW25113)
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAALTREKIIASVAEKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGMEILDPI
AMENAINAIPGVVTVGLFANRGADVALIGTPDGVKTIVK