Protein Info for b2902 in Escherichia coli BW25113

Name: ygfF
Annotation: predicted NAD(P)-binding oxidoreductase with NAD(P)-binding Rossmann-fold domain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF08659: KR" amino acids 3 to 168 (166 residues), 60.9 bits, see alignment E=2.3e-20 PF00106: adh_short" amino acids 3 to 196 (194 residues), 175.6 bits, see alignment E=1.3e-55 PF13561: adh_short_C2" amino acids 11 to 246 (236 residues), 191.9 bits, see alignment E=2.1e-60

Best Hits

Swiss-Prot: 100% identical to YGFF_ECOLI: Uncharacterized oxidoreductase YgfF (ygfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2902)

Predicted SEED Role

"FIG00553873: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P52037 at UniProt or InterPro

Protein Sequence (247 amino acids)

>b2902 predicted NAD(P)-binding oxidoreductase with NAD(P)-binding Rossmann-fold domain (NCBI) (Escherichia coli BW25113)
MAIALVTGGSRGIGRATALLLAQEGYTVAVNYQQNLHAAQEVMNLITQAGGKAFVLQADI
SDENQVVAMFTAIDQHDEPLAALVNNAGILFTQCTVENLTAERINRVLSTNVTGYFLCCR
EAVKRMALKNGGSGGAIVNVSSVASRLGSPGEYVDYAASKGAIDTLTTGLSLEVAAQGIR
VNCVRPGFIYTEMHASGGEPGRVDRVKSNIPMQRGGQAEEVAQAIVWLLSDKASYVTGSF
IDLAGGK