Protein Info for b2865 in Escherichia coli BW25113

Name: b2865
Annotation: putative lipoprotein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF01476: LysM" amino acids 42 to 84 (43 residues), 61.3 bits, see alignment 6.7e-21 PF01551: Peptidase_M23" amino acids 145 to 238 (94 residues), 113.2 bits, see alignment E=5.5e-37

Best Hits

Swiss-Prot: 100% identical to YGER_ECOLI: Uncharacterized lipoprotein YgeR (ygeR) from Escherichia coli (strain K12)

KEGG orthology group: K12943, lipoprotein YgeR (inferred from 100% identity to eco:b2865)

MetaCyc: 100% identical to amidase activator (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Uncharacterized lipoprotein YgeR precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46798 at UniProt or InterPro

Protein Sequence (251 amino acids)

>b2865 putative lipoprotein (VIMSS) (Escherichia coli BW25113)
MSAGRLNKKSLGIVMLLSVGLLLAGCSGSKSSDTGTYSGSVYTVKRGDTLYRISRTTGTS
VKELARLNGISPPYTIEVGQKLKLGGAKSSSITRKSTAKSTTKTASVTPSSAVPKSSWPP
VGQRCWLWPTTGKVIMPYSTADGGNKGIDISAPRGTPIYAAGAGKVVYVGNQLRGYGNLI
MIKHSEDYITAYAHNDTMLVNNGQSVKAGQKIATMGSTDAASVRLHFQIRYRATAIDPLR
YLPPQGSKPKC