Protein Info for b2838 in Escherichia coli BW25113

Name: lysA
Annotation: diaminopimelate decarboxylase, PLP-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 TIGR01048: diaminopimelate decarboxylase" amino acids 6 to 418 (413 residues), 487.5 bits, see alignment E=1.3e-150 PF00278: Orn_DAP_Arg_deC" amino acids 30 to 376 (347 residues), 88.1 bits, see alignment E=3.8e-29 PF02784: Orn_Arg_deC_N" amino acids 33 to 275 (243 residues), 228.4 bits, see alignment E=9e-72

Best Hits

Swiss-Prot: 100% identical to DCDA_ECOLW: Diaminopimelate decarboxylase (lysA) from Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / NCIMB 8666 / NRRL B-766 / W)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to eco:b2838)

MetaCyc: 100% identical to diaminopimelate decarboxylase (Escherichia coli K-12 substr. MG1655)
Diaminopimelate decarboxylase. [EC: 4.1.1.20]

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P00861 at UniProt or InterPro

Protein Sequence (420 amino acids)

>b2838 diaminopimelate decarboxylase, PLP-binding (NCBI) (Escherichia coli BW25113)
MPHSLFSTDTDLTAENLLRLPAEFGCPVWVYDAQIIRRQIAALKQFDVVRFAQKACSNIH
ILRLMREQGVKVDSVSLGEIERALAAGYNPQTHPDDIVFTADVIDQATLERVSELQIPVN
AGSVDMLDQLGQVSPGHRVWLRVNPGFGHGHSQKTNTGGENSKHGIWYTDLPAALDVIQR
HHLQLVGIHMHIGSGVDYAHLEQVCGAMVRQVIEFGQDLQAISAGGGLSVPYQQGEEAVD
TEHYYGLWNAAREQIARHLGHPVKLEIEPGRFLVAQSGVLITQVRSVKQMGSRHFVLVDA
GFNDLMRPAMYGSYHHISALAADGRSLEHAPTVETVVAGPLCESGDVFTQQEGGNVETRA
LPEVKAGDYLVLHDTGAYGASMSSNYNSRPLLPEVLFDNGQARLIRRRQTIEELLALELL