Protein Info for b2828 in Escherichia coli BW25113

Name: lgt
Annotation: prolipoprotein diacylglyceryl transferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 1 to 287 (287 residues), 376.9 bits, see alignment E=3e-117 PF01790: LGT" amino acids 13 to 280 (268 residues), 263.4 bits, see alignment E=8.7e-83

Best Hits

Swiss-Prot: 100% identical to LGT_ECOL6: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 100% identity to eco:b2828)

MetaCyc: 100% identical to phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (Escherichia coli K-12 substr. MG1655)
RXN0-20 [EC: 2.5.1.145]

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.- or 2.5.1.145

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P60955 at UniProt or InterPro

Protein Sequence (291 amino acids)

>b2828 prolipoprotein diacylglyceryl transferase (NCBI) (Escherichia coli BW25113)
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL
LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT
KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN
PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI
IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS