Protein Info for b2827 in Escherichia coli BW25113

Name: thyA
Annotation: thymidylate synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to TYSY_ECO81: Thymidylate synthase (thyA) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 100% identity to eco:b2827)

MetaCyc: 100% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
folate transformations III (E. coli) (9/9 steps found)
pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
folate transformations II (plants) (10/11 steps found)
pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
pyrimidine deoxyribonucleosides salvage (4/5 steps found)
pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A884 at UniProt or InterPro

Protein Sequence (264 amino acids)

>b2827 thymidylate synthase (NCBI) (Escherichia coli BW25113)
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELL
WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLK
NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIF
DYRFEDFEIEGYDPHPGIKAPVAI