Protein Info for b2806 in Escherichia coli BW25113

Name: ygdE
Annotation: predicted methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF18125: RlmM_FDX" amino acids 1 to 71 (71 residues), 100.8 bits, see alignment E=7.2e-33 PF21239: RLMM_N" amino acids 84 to 164 (81 residues), 129.2 bits, see alignment E=7.5e-42 PF01728: FtsJ" amino acids 186 to 280 (95 residues), 41.1 bits, see alignment E=2.9e-14

Best Hits

Swiss-Prot: 100% identical to RLMM_ECO5E: Ribosomal RNA large subunit methyltransferase M (rlmM) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K06968, ribosomal RNA large subunit methyltransferase M [EC: 2.1.1.-] (inferred from 100% identity to eco:b2806)

MetaCyc: 100% identical to 23S rRNA 2'-O-ribose C2498 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11589 [EC: 2.1.1.186]

Predicted SEED Role

"LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.186

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ADR6 at UniProt or InterPro

Protein Sequence (366 amino acids)

>b2806 predicted methyltransferase (NCBI) (Escherichia coli BW25113)
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELP
FSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFC
RKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKF
PADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVD
NGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWAAVG
GRRDER