Protein Info for b2765 in Escherichia coli BW25113

Name: ygcM
Annotation: 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00039: 6-pyruvoyl tetrahydropterin synthase/QueD family protein
  • amino acids 4 to 120 (117 residues), 130.4 bits, E=4.6e-42
• TIGR03367: queuosine biosynthesis protein QueD
  • amino acids 6 to 97 (92 residues), 111.2 bits, E=2.5e-36
• PF01242: PTPS
  • amino acids 6 to 121 (116 residues), 124.7 bits, E=1e-40

Best Hits

Swiss-Prot: 100% identical to QUED_ECOLI: 6-carboxy-5,6,7,8-tetrahydropterin synthase (queD) from Escherichia coli (strain K12)

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 100% identity to eco:b2765)

MetaCyc: 100% identical to 6-carboxy-5,6,7,8-tetrahydropterin synthase (Escherichia coli K-12 substr. MG1655)
RXN0-5507 [EC: 4.1.2.50]

Predicted SEED Role

No annotation

MetaCyc Pathways

• preQ₀ biosynthesis (3/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

See P65870 at UniProt or InterPro

Protein Sequence (121 amino acids)

>b2765 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) (NCBI) (Escherichia coli BW25113)
MMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKA
AFKPTYERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG
E