Protein Info for b2753 in Escherichia coli BW25113

Name: iap
Annotation: aminopeptidase in alkaline phosphatase isozyme conversion (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04389: Peptidase_M28" amino acids 100 to 330 (231 residues), 111 bits, see alignment E=6.1e-36

Best Hits

Swiss-Prot: 100% identical to IAP_ECOLI: Alkaline phosphatase isozyme conversion protein (iap) from Escherichia coli (strain K12)

KEGG orthology group: K09612, alkaline phosphatase isozyme conversion protein [EC: 3.4.11.-] (inferred from 100% identity to eco:b2753)

MetaCyc: 100% identical to alkaline phosphatase isozyme conversion protein (Escherichia coli K-12 substr. MG1655)
3.4.11.-

Predicted SEED Role

"Alkaline phosphatase isozyme conversion protein precursor (EC 3.4.11.-)" (EC 3.4.11.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.-

Use Curated BLAST to search for 3.4.11.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P10423 at UniProt or InterPro

Protein Sequence (345 amino acids)

>b2753 aminopeptidase in alkaline phosphatase isozyme conversion (NCBI) (Escherichia coli BW25113)
MFSALRHRTAALALGVCFILPVHASSPKPGDFANTQARHIATFFPGRMTGTPAEMLSADY
IRQQFQQMGYRSDIRTFNSRYIYTARDNRKSWHNVTGSTVIAAHEGKAPQQIIIMAHLDT
YAPLSDADADANLGGLTLQGMDDNAAGLGVMLELAERLKNTPTEYGIRFVATSGEEEGKL
GAENLLKRMSDTEKKNTLLVINLDNLIVGDKLYFNSGVKTPEAVRKLTRDRALAIARSHG
IAATTNPGLNKNYPKGTGCCNDAEIFDKAGIAVLSVEATNWNLGNKDGYQQRAKTPAFPA
GNSWHDVRLDNHQHIDKALPGRIERRCRDVMRIMLPLVKELAKAS