Protein Info for b2720 in Escherichia coli BW25113

Name: hycF
Annotation: formate hydrogenlyase complex iron-sulfur protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF13237: Fer4_10" amino acids 33 to 86 (54 residues), 39.2 bits, see alignment E=1.9e-13 PF12837: Fer4_6" amino acids 36 to 55 (20 residues), 24.4 bits, see alignment (E = 7.5e-09) PF00037: Fer4" amino acids 36 to 56 (21 residues), 28.8 bits, see alignment (E = 2.7e-10) amino acids 70 to 91 (22 residues), 33 bits, see alignment (E = 1.3e-11) PF13187: Fer4_9" amino acids 39 to 90 (52 residues), 34.7 bits, see alignment E=5e-12 PF12838: Fer4_7" amino acids 39 to 89 (51 residues), 50.3 bits, see alignment E=9.2e-17

Best Hits

Swiss-Prot: 100% identical to HYCF_ECOLI: Formate hydrogenlyase subunit 6 (hycF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2720)

MetaCyc: 100% identical to hydrogenase 3 iron-sulfur protein HycF (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase complex 3 iron-sulfur protein; Formate hydrogenlyase subunit 6; Ni,Fe-hydrogenase III medium subunit"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P16432 at UniProt or InterPro

Protein Sequence (180 amino acids)

>b2720 formate hydrogenlyase complex iron-sulfur protein (NCBI) (Escherichia coli BW25113)
MFTFIKKVIKTGTATSSYPLEPIAVDKNFRGKPEQNPQQCIGCAACVNACPSNALTVETD
LATGELAWEFNLGHCIFCGRCEEVCPTAAIKLSQEYELAVWKKEDFLQQSRFALCNCRVC
NRPFAVQKEIDYAIALLKHNGDSRAENHRESFETCPECKRQKCLVPSDRIELTRHMKEAI