Protein Info for b2664 in Escherichia coli BW25113

Name: ygaE
Annotation: putative transcriptional regulator (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00392: GntR" amino acids 10 to 66 (57 residues), 46.1 bits, see alignment E=3.1e-16 PF07729: FCD" amino acids 76 to 206 (131 residues), 69.2 bits, see alignment E=4.6e-23

Best Hits

Swiss-Prot: 100% identical to GLAR_ECOLI: HTH-type transcriptional repressor GlaR (glaR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2664)

Predicted SEED Role

"CsiR, transcriptional repressor of CsiD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37338 at UniProt or InterPro

Protein Sequence (220 amino acids)

>b2664 putative transcriptional regulator (VIMSS) (Escherichia coli BW25113)
MTITSLDGYRWLKNDIIRGNFQPDEKLRMSLLTSRYALGVGPLREALSQLVAERLVTVVN
QKGYRVASMSEQELLDIFDARANMEAMLVSLAIARGGDEWEADVLAKAHLLSKLEACDAS
EKMLDEWDLRHQAFHTAIVAGCGSHYLLQMRERLFDLAARYRFIWLRRTVLSVEMLEDKH
DQHQTLTAAVLARDTARASELMRQHLLTPIPIIQQAMAGN