Protein Info for b2644 in Escherichia coli BW25113

Name: yfjY
Annotation: CP4-57 prophage; predicted DNA repair protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR00608: DNA repair protein RadC" amino acids 36 to 160 (125 residues), 156.1 bits, see alignment E=5.7e-50 PF04002: RadC" amino acids 40 to 159 (120 residues), 158.9 bits, see alignment E=2.5e-51

Best Hits

Swiss-Prot: 100% identical to YFJY_ECOLI: UPF0758 protein YfjY (yfjY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2644)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P52140 at UniProt or InterPro

Protein Sequence (160 amino acids)

>b2644 CP4-57 prophage; predicted DNA repair protein (NCBI) (Escherichia coli BW25113)
MMEQSLIPQTPVLPLTAQRTVKRALTLLDRHLRETGVAFTSTQAARDWLKLKMAGLEREE
FMMLYLNQQNQLIAHETLFAGSISSTEVHPREVVKRALYFNAAAVILAHNHPSGDTTPSQ
ADKTITQRLVQALQLVDIRVPDHLIVGGRQIYSFAEHGLL