Protein Info for b2585 in Escherichia coli BW25113

Name: pssA
Annotation: phosphatidylserine synthase; phospholipid synthesis (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF00614: PLDc" amino acids 134 to 159 (26 residues), 24.9 bits, see alignment (E = 1.6e-09) amino acids 353 to 379 (27 residues), 34.9 bits, see alignment (E = 1.1e-12) PF13091: PLDc_2" amino acids 258 to 406 (149 residues), 77.5 bits, see alignment E=8.7e-26

Best Hits

Swiss-Prot: 100% identical to PSS_ECOLI: CDP-diacylglycerol--serine O-phosphatidyltransferase (pssA) from Escherichia coli (strain K12)

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 100% identity to eco:b2585)

MetaCyc: 100% identical to phosphatidylserine synthase (Escherichia coli K-12 substr. MG1655)
CDP-diacylglycerol--serine O-phosphatidyltransferase. [EC: 2.7.8.8]

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P23830 at UniProt or InterPro

Protein Sequence (451 amino acids)

>b2585 phosphatidylserine synthase; phospholipid synthesis (VIMSS) (Escherichia coli BW25113)
MLSKFKRNKHQQHLAQLPKISQSVDDVDFFYAPADFRETLLEKIASAKQRICIVALYLEQ
DDGGKGILNALYEAKRQRPELDVRVLVDWHRAQRGRIGAAASNTNADWYCRMAQENPGVD
VPVYGVPINTREALGVLHFKGFIIDDSVLYSGASLNDVYLHQHDKYRYDRYHLIRNRKMS
DIMFEWVTQNIMNGRGVNRLDDVNRPKSPEIKNDIRLFRQELRDAAYHFQGDADNDQLSV
TPLVGLGKSSLLNKTIFHLMPCAEQKLTICTPYFNLPAILVRNIIQLLREGKKVEIIVGD
KTANDFYIPEDEPFKIIGALPYLYEINLRRFLSRLQYYVNTDQLVVRLWKDDDNTYHLKG
MWVDDKWMLITGNNLNPRAWRLDLENAILIHDPQLELAPQREKELELIREHTTIVKHYRD
LQSIADYPVKVRKLIRRLRRIRIDRLISRIL