Protein Info for b2555 in Escherichia coli BW25113

Name: yfhG
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF13942: Lipoprotein_20" amino acids 44 to 217 (174 residues), 269.4 bits, see alignment E=7.3e-85

Best Hits

Swiss-Prot: 100% identical to QSEG_ECO57: Quorum-sensing regulator protein G (qseG) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b2555)

Predicted SEED Role

"putative alpha helix protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AD44 at UniProt or InterPro

Protein Sequence (237 amino acids)

>b2555 hypothetical protein (NCBI) (Escherichia coli BW25113)
MRHIFQRLLPRRLWLAGLPCLALLGCVQNHNKPAIDTPAEEKIPVYQLADYLSTECSDIW
ALQGKSTETNPLYWLRAMDCADRLMPAQSRQQARQYDDGSWQNTFKQGILLADAKITPYE
RRQLVARIEALSTEIPAQVRPLYQLWRDGQALQLQLAEERQRYSKLQQSSDSELDTLRQQ
HHVLQQQLELTTRKLENLTDIERQLSTRKPAGNFSPDTPHESEKPAPSTHEVTPDEP