Protein Info for b2545 in Escherichia coli BW25113

Name: yphC
Annotation: putative oxidoreductase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 178 to 194 (17 residues), see Phobius details PF08240: ADH_N" amino acids 28 to 146 (119 residues), 87.4 bits, see alignment E=1.4e-28 PF16912: Glu_dehyd_C" amino acids 176 to 338 (163 residues), 40.3 bits, see alignment E=5.3e-14 PF00107: ADH_zinc_N" amino acids 185 to 312 (128 residues), 92.9 bits, see alignment E=3.1e-30 PF13602: ADH_zinc_N_2" amino acids 239 to 349 (111 residues), 27.4 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 100% identical to YPHC_ECOLI: Uncharacterized zinc-type alcohol dehydrogenase-like protein YphC (yphC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2545)

Predicted SEED Role

"Hypothetical zinc-type alcohol dehydrogenase-like protein YphC" in subsystem Unknown sugar utilization (cluster yphABCDEFG)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77360 at UniProt or InterPro

Protein Sequence (353 amino acids)

>b2545 putative oxidoreductase (VIMSS) (Escherichia coli BW25113)
MKTMLAAYLPGNSTVDLREVAVPTPGINQVLIKMKSSGICGSDVHYIYHQHRATAAAPDK
PLYQGFINGHEPCGQIVAMGQGCRHFKEGDRVLVYHISGCGFCPNCRRGFPISCTGEGKA
AYGWQRDGGHAEYLLAEEKDLILLPDALSYEDGAFISCGVGTAYEGILRGEVSGSDNVLV
VGLGPVGMMAMMLAKGRGAKRIIGVDMLPERLAMAKQLGVMDHGYLATTEGLPQIIAELT
HGGADVALDCSGNAAGRLLALQSTADWGRVVYIGETGKVEFEVSADLMHHQRRIIGSWVT
SLFHMEKCAHDLTDWKLWPRNAITHRFSLEQAGDAYALMASGKCGKVVINFPD