Protein Info for b2541 in Escherichia coli BW25113
Name: hcaB
Annotation: 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to HCAB_ECOLI: 3-phenylpropionate-dihydrodiol/cinnamic acid-dihydrodiol dehydrogenase (hcaB) from Escherichia coli (strain K12)
KEGG orthology group: K05711, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase [EC: 1.3.1.-] (inferred from 100% identity to eco:b2541)MetaCyc: 100% identical to 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase (Escherichia coli K-12 substr. MG1655)
PHENPRODIOLDEHYDROG-RXN [EC: 1.3.1.87]; 1.3.1.87 [EC: 1.3.1.87]
Predicted SEED Role
"2,3-dihydroxy-2,3-dihydro-phenylpropionate dehydrogenase (EC 1.3.1.-)" in subsystem Cinnamic Acid Degradation or Naphtalene and antracene degradation or Phenylpropanoid compound degradation or Phenylpropionate Degradation (EC 1.3.1.-)
MetaCyc Pathways
- 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (8/8 steps found)
- 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (5/5 steps found)
- cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (5/5 steps found)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- Biosynthesis of unsaturated fatty acids
- Fatty acid biosynthesis
- Fluorene degradation
- Fluorobenzoate degradation
- Isoflavonoid biosynthesis
- Phenylalanine metabolism
- Propanoate metabolism
- Tryptophan metabolism
- gamma-Hexachlorocyclohexane degradation
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.3.1.- or 1.3.1.87
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0CI31 at UniProt or InterPro
Protein Sequence (270 amino acids)
>b2541 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase (NCBI) (Escherichia coli BW25113) MSDLHNESIFITGGGSGLGLALVERFIEEGAQVATLELSAAKVASLRQRFGEHILAVEGN VTCYADYQRAVDQILTRSGKLDCFIGNAGIWDHNASLVNTPAETLETGFHELFNVNVLGY LLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPKVRV NGVGPCGMASDLRGPQALGQSETSIMQSLTPEKIAAILPLQFFPQPADFTGPYVMLTSRR NNRALSGVMINADAGLAIRGIRHVAAGLDL