Protein Info for b2535 in Escherichia coli BW25113

Name: csiE
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00874: PRD" amino acids 131 to 216 (86 residues), 42.5 bits, see alignment E=3.3e-15 amino acids 240 to 328 (89 residues), 42.8 bits, see alignment E=2.7e-15

Best Hits

Swiss-Prot: 100% identical to CSIE_ECOLI: Stationary phase-inducible protein CsiE (csiE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2535)

Predicted SEED Role

"Stationary phase inducible protein CsiE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P54901 at UniProt or InterPro

Protein Sequence (426 amino acids)

>b2535 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MMPTLAPPSVLSAPQRRCQILLTLFQPGLTATMATFSELNGVDDDIASLDISETGREILR
YHQLTLTTGYDGSYRVEGTVLNQRLCLFHWLRRGFRLCPSFITSQFTPALKSELKRRGIA
RNFYDDTNLQALVNLCSRRLQKRFESRDIHFLCLYLQYCLLQHHAGITPQFNPLQRRWAE
SCLEFQVAQEIGRHWQRRALQPVPPDEPLFMALLFSMLRVPDPLRDAHQRDRQLRQSIKR
LVNHFRELGNVRFYDEQGLCDQLYTHLAQALNRSLFAIGIDNTLPEEFARLYPRLVRTTR
AALAGFESEYGVHLSDEESGLVAVIFGAWLMQENDLHEKQIILLTGNDSEREAQIEQQLR
ELTLLPLNIKHMSVKAFLQTGAPRGAALIIAPYTMPLPLFSPPLIYTDLTLTTHQQEQIR
KMLESA