Protein Info for b2527 in Escherichia coli BW25113

Name: hscB
Annotation: co-chaperone HscB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 TIGR00714: Fe-S protein assembly co-chaperone HscB" amino acids 13 to 168 (156 residues), 227.6 bits, see alignment E=3.7e-72 PF07743: HSCB_C" amino acids 88 to 161 (74 residues), 65.6 bits, see alignment E=2.2e-22

Best Hits

Swiss-Prot: 100% identical to HSCB_ECOLI: Co-chaperone protein HscB (hscB) from Escherichia coli (strain K12)

KEGG orthology group: K04082, molecular chaperone HscB (inferred from 100% identity to eco:b2527)

MetaCyc: 100% identical to [Fe-S] cluster biosynthesis co-chaperone HscB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Chaperone protein HscB" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A6L9 at UniProt or InterPro

Protein Sequence (171 amino acids)

>b2527 co-chaperone HscB (NCBI) (Escherichia coli BW25113)
MDYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQLAAVQQSATINQAWQT
LRHPLMRAEYLLSLHGFDLASEQHTVRDTAFLMEQLELREELDEIEQAKDEARLESFIKR
VKKMFDTRHQLMVEQLDNETWDAAADTVRKLRFLDKLRSSAEQLEEKLLDF