Protein Info for b2519 in Escherichia coli BW25113

Name: pbpC
Annotation: fused transglycosylase/transpeptidase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 770 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02073: penicillin-binding protein 1C" amino acids 37 to 770 (734 residues), 919.7 bits, see alignment E=7.8e-281 PF00912: Transgly" amino acids 61 to 226 (166 residues), 176.4 bits, see alignment E=5.9e-56 PF00905: Transpeptidase" amino acids 306 to 519 (214 residues), 45.4 bits, see alignment E=9.4e-16 PF06832: BiPBP_C" amino acids 687 to 767 (81 residues), 62.1 bits, see alignment E=5.9e-21

Best Hits

Swiss-Prot: 100% identical to PBPC_ECOLI: Penicillin-binding protein 1C (pbpC) from Escherichia coli (strain K12)

KEGG orthology group: K05367, penicillin-binding protein 1C [EC: 2.4.1.-] (inferred from 100% identity to eco:b2519)

MetaCyc: 100% identical to peptidoglycan glycosyltransferase PbpC (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Penicillin-insensitive transglycosylase (EC 2.4.2.-) & transpeptidase PBP-1C" in subsystem Peptidoglycan Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.1.129, 2.4.2.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.129 or 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76577 at UniProt or InterPro

Protein Sequence (770 amino acids)

>b2519 fused transglycosylase/transpeptidase (NCBI) (Escherichia coli BW25113)
MPRLLTKRGCWITLAAAPFLLFLAAWGADKLWPLPLHEVNPARVVVAQDGTPLWRFADAD
GIWRYPVTIEDVSPRYLEALINYEDRWFWKHPGVNPFSVARAAWQDLTSGRVISGGSTLT
MQVARLLDPHPKTFGGKIRQLWRALQLEWHLSKREILTLYLNRAPFGGTLQGIGAASWAY
LGKSPANLSYSEAAMLAVLPQAPSRLRPDRWPERAEAARNKVLERMAVQGVWSREQVKES
REEPIWLAPRQMPQLAPLFSRMMLGKSKSDKITTTLDAGLQRRLEELAQNWKGRLPPRSS
LAMIVVDHTDMRVRGWVGSVDLNDDSRFGHVDMVNSIRSPGSVLKPFVYGLALDEGLIHP
ASLLQDVPRRTGDYRPGNFDSGFHGPISMSEALVRSLNLPAVQVLEAYGPKRFAAKLRNV
GLPLYLPNGAAPNLSLILGGAGAKLEDMAAAYTAFARHGKAGKLRLQPDDPLLERPLMSS
GAAWIIRRIMADEAQPLPDSALPRVAPLAWKTGTSYGYRDAWAIGVNARYVIGIWTGRPD
GTPVVGQFGFASAVPLLNQVNNILLSRSANLPEDPRPNSVTRGVICWPGGQSLPEGDGNC
RRRLATWLLDGSQPPTLLLPEQEGINGIRFPIWLDENGKRVAADCPQARQEMINVWPLPL
EPWLPASERRAVRLPPASTSCPPYGHDAQLPLQLTGVRDGAIIKRLPGAAEATLPLQSSG
GAGERWWFLNGEPLTERGRNVTLHLTDKGDYQLLVMDDVGQIATVKFVMQ