Protein Info for b2517 in Escherichia coli BW25113

Name: yfgB
Annotation: predicted enzyme (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 13 to 369 (357 residues), 593.7 bits, see alignment E=5.4e-183 PF21016: RlmN_N" amino acids 18 to 77 (60 residues), 109.6 bits, see alignment E=4.9e-36 PF04055: Radical_SAM" amino acids 120 to 293 (174 residues), 68.3 bits, see alignment E=9.7e-23

Best Hits

Swiss-Prot: 100% identical to RLMN_ECO27: Dual-specificity RNA methyltransferase RlmN (rlmN) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 100% identity to eco:b2517)

MetaCyc: 100% identical to 23S rRNA m2A2503 methyltransferase/tRNA m2A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11586 [EC: 2.1.1.192]; 2.1.1.- [EC: 2.1.1.192]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.192

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P36979 at UniProt or InterPro

Protein Sequence (384 amino acids)

>b2517 predicted enzyme (NCBI) (Escherichia coli BW25113)
MSEQLVTPENVTTKDGKINLLDLNRQQMREFFKDLGEKPFRADQVMKWMYHYCCDNFDEM
TDINKVLRGKLKEVAEIRAPEVVEEQRSSDGTIKWAIAVGDQRVETVYIPEDDRATLCVS
SQVGCALECKFCSTAQQGFNRNLRVSEIIGQVWRAAKIVGAAKVTGQRPITNVVMMGMGE
PLLNLNNVVPAMEIMLDDFGFGLSKRRVTLSTSGVVPALDKLGDMIDVALAISLHAPNDE
IRDEIVPINKKYNIETFLAAVRRYLEKSNANQGRVTIEYVMLDHVNDGTEHAHQLAELLK
DTPCKINLIPWNPFPGAPYGRSSNSRIDRFSKVLMSYGFTTIVRKTRGDDIDAACGQLAG
DVIDRTKRTLRKRMQGEAIDIKAV