Protein Info for b2512 in Escherichia coli BW25113

Name: yfgL
Annotation: protein assembly complex, lipoprotein component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 8 to 390 (383 residues), 441.6 bits, see alignment E=9.5e-137 PF13360: PQQ_2" amino acids 78 to 319 (242 residues), 200.3 bits, see alignment E=5.9e-63 amino acids 309 to 390 (82 residues), 24.8 bits, see alignment E=2.5e-09

Best Hits

Swiss-Prot: 100% identical to BAMB_ECOLI: Outer membrane protein assembly factor BamB (bamB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2512)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77774 at UniProt or InterPro

Protein Sequence (392 amino acids)

>b2512 protein assembly complex, lipoprotein component (NCBI) (Escherichia coli BW25113)
MQLRKLLLPGLLSVTLLSGCSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNFY
SNLHPALADNVVYAADRAGLVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGG
HVYIGSEKAQVYALNTSDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGA
VKWTVNLDMPSLSLRGESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTE
IDRLSDVDTTPVVVNGVVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVD
QNDRVMALTIDGGVTLWTQSDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQ
KVDSSGFQTEPVAADGKLLIQAKDGTVYSITR