Protein Info for b2440 in Escherichia coli BW25113

Name: eutC
Annotation: ethanolamine ammonia-lyase small subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF05985: EutC" amino acids 65 to 293 (229 residues), 273.3 bits, see alignment E=7.5e-86

Best Hits

Swiss-Prot: 100% identical to EUTC_ECOL5: Ethanolamine ammonia-lyase light chain (eutC) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K03736, ethanolamine ammonia-lyase small subunit [EC: 4.3.1.7] (inferred from 100% identity to eco:b2440)

MetaCyc: 100% identical to ethanolamine ammonia-lyase subunit beta (Escherichia coli K-12 substr. MG1655)
Ethanolamine ammonia-lyase. [EC: 4.3.1.7]

Predicted SEED Role

"Ethanolamine ammonia-lyase light chain (EC 4.3.1.7)" in subsystem Ethanolamine utilization (EC 4.3.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.7

Use Curated BLAST to search for 4.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P19636 at UniProt or InterPro

Protein Sequence (295 amino acids)

>b2440 ethanolamine ammonia-lyase small subunit (NCBI) (Escherichia coli BW25113)
MDQKQIEEIVRSVMASMGQAAPAPSEAKCATTNCAAPVTSESCALDLGSAEAKAWIGVEN
PHRADVLTELRRSTVARVCTGRAGPRPRTQALLRFLADHSRSKDTVLKEVPEEWVKAQGL
LEVRSEISDKNLYLTRPDMGRRLCAEAVEALKAQCVANPDVQVVISDGLSTDAITVNYEE
ILPPLMAGLKQAGLKVGTPFFVRYGRVKIEDQIGEILGAKVVILLVGERPGLGQSESLSC
YAVYSPRMATTVEADRTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKASGINMTR