Protein Info for b2430 in Escherichia coli BW25113

Name: b2430
Annotation: putative beta-lactamase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00144: Beta-lactamase" amino acids 44 to 412 (369 residues), 233.4 bits, see alignment E=2.1e-73

Best Hits

Swiss-Prot: 100% identical to YFEW_ECOLI: Putative D-alanyl-D-alanine carboxypeptidase (yfeW) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2430)

MetaCyc: 100% identical to penicillin binding protein 4B (Escherichia coli K-12 substr. MG1655)
Serine-type D-Ala-D-Ala carboxypeptidase. [EC: 3.4.16.4]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77619 at UniProt or InterPro

Protein Sequence (434 amino acids)

>b2430 putative beta-lactamase (VIMSS) (Escherichia coli BW25113)
MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQVDVGYPSVNL
LIIKDNQIVYRKAWGAAKKYDGSVLMEQPVKATTGTLYDLASNTKMYATNFALQKLMSEG
KLHPDDRIAKYIPGFADSPNDTIKGKNTLRISDLLHHSGGFPADPQYPNKAVAGALYSQD
KGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESIYRPLGLTHT
VFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSMGGVSGHAGL
FSNTGDIAVLMQTMLNGGGYGDVQLFNAETVKMFTTSSKEDATFGLGWRVNGNATMTPTF
GTLASPQTYGHTGWTGTVTVIDPVNHMTIVMLSNKPHSPVADPQKNPNMFESGQLPIATY
GWVVDQVYAALKQK