Protein Info for b2426 in Escherichia coli BW25113

Name: ucpA
Annotation: putative oxidoreductase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00106: adh_short" amino acids 7 to 199 (193 residues), 197.8 bits, see alignment E=2.1e-62 PF08659: KR" amino acids 8 to 167 (160 residues), 67.5 bits, see alignment E=2.3e-22 PF13561: adh_short_C2" amino acids 13 to 254 (242 residues), 233.8 bits, see alignment E=3.2e-73

Best Hits

Swiss-Prot: 100% identical to UCPA_ECOLI: Oxidoreductase UcpA (ucpA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2426)

MetaCyc: 100% identical to oxidoreductase UcpA (Escherichia coli K-12 substr. MG1655)
RXN-11032 [EC: 1.1.1.304]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.304

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37440 at UniProt or InterPro

Protein Sequence (263 amino acids)

>b2426 putative oxidoreductase (VIMSS) (Escherichia coli BW25113)
MGKLTGKTALITGALQGIGEGIARTFARHGANLILLDISPEIEKLADELCGRGHRCTAVV
ADVRDPASVAAAIKRAKEKEGRIDILVNNAGVCRLGSFLDMSDDDRDFHIDINIKGVWNV
TKAVLPEMIARKDGRIVMMSSVTGDMVADPGETAYALTKAAIVGLTKSLAVEYAQSGIRV
NAICPGYVRTPMAESIARQSNPEDPESVLTEMAKAIPMRRLADPLEVGELAAFLASDESS
YLTGTQNVIDGGSTLPETVSVGI